PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G490200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 206aa    MW: 22297.2 Da    PI: 5.1422
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G490200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.25.8e-43421411100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC+++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdP+yG++gvi +lq+q+++l++
  Aqcoe1G490200.1.p  42 PCAACKILRRKCVENCVLAPYFPPSEPVKFTTAHRVFGASNIIKFLQELPECQRADAVSSMVYEANARIRDPIYGCAGVICHLQKQVNELQV 133
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  Aqcoe1G490200.1.p 134 QLAMTQAE 141
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.29441142IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-4342139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MDSNGYTPTS ATSSPLSSSP STSSHNSSLP PTSTPSVVVV SPCAACKILR RKCVENCVLA  60
PYFPPSEPVK FTTAHRVFGA SNIIKFLQEL PECQRADAVS SMVYEANARI RDPIYGCAGV  120
ICHLQKQVNE LQVQLAMTQA EIVNIQCQNA NLALIYMNMV QAQQTSSVSE QSFNNSVENS  180
PNILTTNGGF FDDNNVCSLW EPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010244970.12e-83PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK083e-71LBD11_ARATH; LOB domain-containing protein 11
TrEMBLK7M3862e-81K7M386_SOYBN; Uncharacterized protein
STRINGGLYMA13G40370.25e-81(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-68LOB domain-containing protein 11